DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and Prss34

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:287 Identity:84/287 - (29%)
Similarity:130/287 - (45%) Gaps:57/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MGNVIDLDKYFEEADLNSQE---RVVGGYDVPEDEYVPYQVSMQ-FLTRSGKMRHFCGGSLIAPN 86
            :||.:.|     ..||.|.:   .:|||..|....: |:|||:: :.....:..|.||||||.|.
Mouse    16 LGNTMPL-----TLDLGSGQGLVGIVGGCPVSASRF-PWQVSLRLYDMEHSRWEHECGGSLIHPQ 74

  Fly    87 RVLTAAHCVNGQNASRISVVAGIRDLNDSSGFRSQVQSYEMNENYQELVT--------------- 136
            .||||||||..:..             ::.|.|.||....:.||.|.:..               
Mouse    75 WVLTAAHCVRPKEV-------------EAYGVRVQVGQLRLYENDQLMKVVKIIRHPKFSEKLSA 126

  Fly   137 ---SDIAILKIDPPFELDEKRVSTIDVSGSDM-VGADQEVLLTGWGSVFHFGTGPFAKYPTVLQK 197
               :|||:||:|....|.| .|..:.:..:.: :.:.:...:.|||.:.::...|   .|..|::
Mouse   127 RGGADIALLKLDTRVVLSE-HVYPVSLPAASLRISSKKTCWVAGWGVIENYMPLP---PPYHLRE 187

  Fly   198 LDYKTLSNSKCKE----------TMTQLTDTEICALERFGKGACNGDSGGPLVMKSGESYKQVGV 252
            :....:.|:.|::          |...:.|..:|| .:.|:.:|..|||||||.:...|:.||||
Mouse   188 VAVPIVENNDCEQKYQTNSSSDSTTRIIKDDMLCA-GKEGRDSCKADSGGPLVCRWNCSWVQVGV 251

  Fly   253 VSYGTAFCASNNPDVYTRVSMFDGWIK 279
            ||:|......:.|.|||||..:..|||
Mouse   252 VSWGIGCGLPDFPGVYTRVMSYVSWIK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 75/261 (29%)
Tryp_SPc 47..280 CDD:238113 78/263 (30%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 76/261 (29%)
Tryp_SPc 35..277 CDD:214473 75/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.