DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG9673

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:262 Identity:81/262 - (30%)
Similarity:127/262 - (48%) Gaps:46/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ADLNSQERVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNG-----Q 98
            |:.:.|.|::||.||.:.|| |:..|:::     ...|.|.|::|:.|.:|||||||:.     .
  Fly    21 AEASPQGRILGGEDVAQGEY-PWSASVRY-----NKAHVCSGAIISTNHILTAAHCVSSVGITPV 79

  Fly    99 NASRISVVAGIRDLND-SSGFRSQVQSYEMNENYQELVTSDIAILKID--------------PPF 148
            :||.::|..|  .:|. :.|....|:|..::.:|...: .|||||::|              || 
  Fly    80 DASTLAVRLG--TINQYAGGSIVNVKSVIIHPSYGNFL-HDIAILELDETLVFSDRIQDIALPP- 140

  Fly   149 ELDEKRVSTIDVSGSDMVGADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKETMT 213
            ..||:   |.||......|.  .|.:.|||.:.. ||..:.:     ||.:|.|||.|.|:....
  Fly   141 TTDEE---TEDVDAELPNGT--PVYVAGWGELSD-GTASYKQ-----QKANYNTLSRSLCEWEAG 194

  Fly   214 QLTDTEICALERFGKGACNGDSGGPLVMKSGESYKQV-GVVSYGTAFCASNNPDVYTRVSMFDGW 277
            ...::.:|.....|:|.|.||:|..::    :..|.: |:.|:....|.|..|||.||||.:..|
  Fly   195 YGYESVVCLSRAEGEGICRGDAGAAVI----DDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTW 255

  Fly   278 IK 279
            |:
  Fly   256 IE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 77/252 (31%)
Tryp_SPc 47..280 CDD:238113 78/254 (31%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 77/252 (31%)
Tryp_SPc 29..259 CDD:238113 78/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449472
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.