DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG33160

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:272 Identity:75/272 - (27%)
Similarity:119/272 - (43%) Gaps:62/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YFEEADLNSQERVVGGY--DVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNG 97
            |.....:..|.|::||:  .:.|::|:     :|..|    ....|||||:.|..|:||||||..
  Fly    22 YAHPDSVQIQPRIIGGHVSSIKEEKYL-----VQVTT----SEELCGGSLVKPRWVITAAHCVYN 77

  Fly    98 QNASRISVVAGIRDLNDSSGFRSQVQSYEMNENYQELVTSDIAILKIDPPFELDEKRVSTIDVS- 161
            :|.:         |.....|..:|...|        .|...:..:.|.|.|   .::...:||: 
  Fly    78 KNKN---------DFKIYGGASNQAGPY--------AVIRTVDYIAIRPDF---NRKTLNMDVAA 122

  Fly   162 ---GSDMVGADQE--------------VLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCK 209
               .|||:||:.|              |.::|||.:....|....:..:||..:    .|.:.|.
  Fly   123 LRLNSDMIGANIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPM----WSRASCV 183

  Fly   210 ET---MTQLTDTEICALERFGKGACNGDSGGPLVMKSGESYKQVGVVSYGTAFCASNNPDVYTRV 271
            ..   :.::|.:.:||...:.|.:|:||||||||.:.    :..|:||:|.. |||..|.:||.|
  Fly   184 SAFRGIHRITRSMVCAARLYKKDSCDGDSGGPLVYRG----QLAGIVSFGYG-CASALPGIYTSV 243

  Fly   272 SMFDGWIKERMV 283
            .....|. :|:|
  Fly   244 PEIRDWF-QRVV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 70/254 (28%)
Tryp_SPc 47..280 CDD:238113 70/255 (27%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 70/253 (28%)
Tryp_SPc 34..253 CDD:238113 70/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.