DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and Prss42

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001100333.2 Gene:Prss42 / 301027 RGDID:1562548 Length:340 Species:Rattus norvegicus


Alignment Length:251 Identity:74/251 - (29%)
Similarity:123/251 - (49%) Gaps:36/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGIR 110
            :::||.|..|.:: |:|||::.     :..|.|||||:....|||||||::.:....:.      
  Rat    83 KIMGGVDAEEGKW-PWQVSLRV-----RHMHVCGGSLLNSQWVLTAAHCIHSRVQYNVK------ 135

  Fly   111 DLNDSSGFRSQ------VQSYEMNENYQ--ELVTSDIAILKIDPPFELDEKRVSTIDVSGSDMVG 167
             :.|.|.:|..      :|:..::..:.  .:|.:|||:||:..|.............:|:..|.
  Rat   136 -MGDRSVYRQNTSLVIPIQNIFVHPKFSTTTVVQNDIALLKLQQPVNFTSSIHPICVPTGTFHVK 199

  Fly   168 ADQEVLLTGWGSVFHFGTGPFA-KYPT-VLQKLDYKTLSNSKCKETMTQLTDTE--------ICA 222
            |..:..:||||.     ..|.| :.|| :||::|...:...:|.|.:.::..|.        :||
  Rat   200 AGTKCWVTGWGK-----PDPGAPQIPTEILQEVDQSIILYEECNEMLKKMASTSVDLVKRGMVCA 259

  Fly   223 LERFGKGACNGDSGGPLVMKSGESYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWI 278
            .:..||.||.|||||||..:....:.|:||||:|.......:|.|||.|:.::.|:
  Rat   260 YKEGGKDACQGDSGGPLSCEFDNRWVQIGVVSWGIGCGRKGHPGVYTDVAFYNKWL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 73/249 (29%)
Tryp_SPc 47..280 CDD:238113 74/250 (30%)
Prss42NP_001100333.2 Tryp_SPc 83..314 CDD:214473 73/248 (29%)
Tryp_SPc 84..315 CDD:238113 73/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.