DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and Prss45

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:248 Identity:68/248 - (27%)
Similarity:113/248 - (45%) Gaps:28/248 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGIRDL--ND 114
            ::.|..:.|::.|:|.     :.:|.|||:||..:.|::||||:.|.  ...||:.|...|  |.
Mouse    54 NLEESHHWPWEASLQI-----EDKHVCGGALIDRSWVVSAAHCIQGN--KEYSVMLGSSTLHPNG 111

  Fly   115 SS-GFRSQVQSYEMNENY--QELVTSDIAILKIDPPFELDEKRVSTIDVSGSDM---VGADQEVL 173
            || ..:..|....::..|  :..:.||||:|.::.|...: |.|..|.:...:.   ||.  :..
Mouse   112 SSWTLKIPVGDIIIHPKYWGRNFIRSDIALLCLETPVTFN-KYVQPICLPEHNFNFKVGT--KCW 173

  Fly   174 LTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKC-----KETM----TQLTDTEICALERFGKG 229
            :||||.|....:......|. |.:.:...:.|..|     |:|:    ..|....:.....:|:.
Mouse   174 VTGWGQVKQHSSAQLTPAPE-LWEAEVFIIDNKNCDSIFHKKTLYPQVVPLIRKNMICTTNYGED 237

  Fly   230 ACNGDSGGPLVMKSGESYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWIKERM 282
            .|.||.||||..:....:...||.|:..|.....|..||||::.:..|||:::
Mouse   238 LCYGDPGGPLACEIDGRWILAGVFSWEKACATVPNLSVYTRITKYTIWIKDQV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 65/242 (27%)
Tryp_SPc 47..280 CDD:238113 67/244 (27%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 67/240 (28%)
Tryp_SPc 59..286 CDD:214473 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.