DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG30289

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:260 Identity:77/260 - (29%)
Similarity:114/260 - (43%) Gaps:49/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EDEYVP-----YQVSMQ-----FLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGI 109
            :|.|||     .:.::|     .|..|.|.   |||||||...||||||||:.::   :.|..|.
  Fly    35 DDPYVPNIFGGAKTNIQENPWMVLVWSSKP---CGGSLIARQFVLTAAHCVSFED---LYVRLGD 93

  Fly   110 RDLND-----------SSGFRSQVQSYEMNENYQEL-VTSDIAILKIDPPFELDEKRVSTIDVSG 162
            .:..|           ...:...|....::|||..: :.:|||:|::....|..: .|..|.:  
  Fly    94 YETLDPMPYCLNNHCIPKFYNISVDMKIVHENYNGITLQNDIALLRMSEAVEYSD-YVRPICL-- 155

  Fly   163 SDMVGADQEVL----LTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKETMTQLTD-TEICA 222
              :||...:.:    :||||..      .:.::..:|.......:..|.|.....:..| ::|||
  Fly   156 --LVGEQMQSIPMFTVTGWGET------EYGQFSRILLNATLYNMDISYCNIKFNKQADRSQICA 212

  Fly   223 LERFGKGACNGDSGGPLVMKSGESYK----QVGVVSYGTAFCASNNPDVYTRVSMFDGWIKERMV 283
             .......|.|||||||..|.....:    |.|:||||:..||:|...|||.||....||..:||
  Fly   213 -GSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTNVSYHREWIFNKMV 276

  Fly   284  283
              Fly   277  276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 73/253 (29%)
Tryp_SPc 47..280 CDD:238113 75/255 (29%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 69/246 (28%)
Tryp_SPc 42..271 CDD:238113 69/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.