DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG30088

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:274 Identity:73/274 - (26%)
Similarity:117/274 - (42%) Gaps:59/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QERVVGGYDVPEDEYVPYQVS------------------MQFLTRSGKMRHFCGGSLIAPNRVLT 90
            ||:|...:.:|... |.|:.:                  |.:|..|.::.  |||::|:...:||
  Fly    21 QEQVAANFLIPSCG-VSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIH--CGGTIISSRYILT 82

  Fly    91 AAHCVNGQNASRISVVAGIRDLN---DSSGFRSQVQSYEMN-------ENYQELVTSDIAILKI- 144
            ||||:.    ..:.|..|..|:.   |..|......:.|.:       :.:...:.:|||:||: 
  Fly    83 AAHCMR----PYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRFLANDIALLKLS 143

  Fly   145 -DPPFELDEKRVSTI-DVSGSDMVGADQEVLLTGWGSVFHFGTGPFAK--YPTVLQKLDYKTLSN 205
             :..|.:..:.:..| :.:.:..|   .|....|||..   .|...|.  ..|||.:.|     |
  Fly   144 RNIRFNVHIQPICLILNPAAAPNV---HEFQAFGWGQT---ETNHSANVLQTTVLTRYD-----N 197

  Fly   206 SKCKETMTQ-LTDTEICALERFGKGACNGDSGGPLVMKSGES----YKQVGVVSYGTAFCASNNP 265
            ..|:..::. :|..::|...: |...|:||||||||.|....    |.|:|:||:|...|.|  |
  Fly   198 RHCRSVLSMPITINQLCVGFQ-GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQS--P 259

  Fly   266 DVYTRVSMFDGWIK 279
            .|||.|..:..||:
  Fly   260 GVYTYVPNYIRWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 69/269 (26%)
Tryp_SPc 47..280 CDD:238113 71/271 (26%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 65/247 (26%)
Tryp_SPc 45..273 CDD:238113 66/247 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.