DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG30083

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:208 Identity:65/208 - (31%)
Similarity:102/208 - (49%) Gaps:23/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 CGGSLIAPNRVLTAAHCVNGQN--ASRISVVAGIRDLNDSSGFRSQVQSYEMNENYQELVTSDIA 140
            |||:||....||:||||:....  |.|:...:..|....:..||::   |....:|    ::||.
  Fly    64 CGGTLIHKQFVLSAAHCIKRDQILAVRLGEHSSSRYFAVTKAFRNK---YFTTGSY----SNDIG 121

  Fly   141 ILKIDPPFELDEKRVSTIDVSGSDMVGADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSN 205
            ||:|.|..:.:........::....|...:.....|||..   ....|:|   ||:.::...|:.
  Fly   122 ILRIQPIVKFNAVIRPICIITDPTKVPNVKTFKAAGWGKT---ENETFSK---VLKTVELNELNA 180

  Fly   206 SKCKETM-TQLTDTEICALERFGKGACNGDSGGPLV----MKSGESYKQVGVVSYGTAFCASNNP 265
            |:|...: ..:|:::|||....| ..|.|||||||:    |.....|.|:|::|:|::.|  |:|
  Fly   181 SECYNMLWVNVTESQICAGHPDG-DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLC--NSP 242

  Fly   266 DVYTRVSMFDGWI 278
            .||||:|.|..||
  Fly   243 GVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 63/206 (31%)
Tryp_SPc 47..280 CDD:238113 65/208 (31%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 63/206 (31%)
Tryp_SPc 34..255 CDD:238113 63/206 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.