DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG30082

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:260 Identity:72/260 - (27%)
Similarity:117/260 - (45%) Gaps:42/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DLNSQERVVGG--YDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASR 102
            :|....|:|||  .|:..:.::.|      |.::..:  .|.|:||....|||||||::..:.  
  Fly    33 NLPPTNRIVGGRTADIGSNPWLAY------LHKNSSL--VCTGTLITKRFVLTAAHCLHSFHL-- 87

  Fly   103 ISVVAGIRDLNDSSGFRSQ-----VQSYEMNENY-------QELVTSDIAILKIDPP--FELDEK 153
            ::|..|..|.:......|:     .:.|.:...|       ::...:||.:||::..  ::|..:
  Fly    88 LTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIR 152

  Fly   154 RVSTIDVSGSDMVGADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKETM-TQLTD 217
            .:......|.....:..|.  .|||.:....|.      ||||.::...|..|.|:.:: |.|:.
  Fly   153 PICLFRDPGQVPYSSTYEA--AGWGKIDLINTA------TVLQTVNLIRLDQSDCERSLRTSLSY 209

  Fly   218 TEICALERFGKGACNGDSGGPL--VMKSGESYK--QVGVVSYGTAFCASNNPDVYTRVSMFDGWI 278
            .:.|| .::....|:|||||||  .|.:|...:  |:|:||||...|  ..|.|||.|..|..||
  Fly   210 GQFCA-GQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLC--RGPGVYTYVPSFTNWI 271

  Fly   279  278
              Fly   272  271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 69/252 (27%)
Tryp_SPc 47..280 CDD:238113 70/253 (28%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 69/252 (27%)
Tryp_SPc 40..274 CDD:238113 70/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.