DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and PRSS54

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001073961.1 Gene:PRSS54 / 221191 HGNCID:26336 Length:395 Species:Homo sapiens


Alignment Length:318 Identity:70/318 - (22%)
Similarity:119/318 - (37%) Gaps:100/318 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNGVTYFV--LLLSSTLLALGGVQSKPMGNVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQV 63
            |.||...:  ||.|||..   |||...:         |...|  .:|.:|...:      .|:.|
Human    13 MRGVLLVLLGLLYSSTSC---GVQKASV---------FYGPD--PKEGLVSSME------FPWVV 57

  Fly    64 SMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGIRDLNDSSGFRSQ--VQSYE 126
            |:|    ..:..|...|.:::...||:.|..:  ||...|.|:.||.:::.|....::  |.:..
Human    58 SLQ----DSQYTHLAFGCILSEFWVLSIASAI--QNRKDIVVIVGISNMDPSKIAHTEYPVNTII 116

  Fly   127 MNENY-QELVTSDIAILKIDPPFELDEKRVSTIDVSGSDMVGADQEVLLTGWGSVFHFGT----- 185
            ::|:: ...::::||:||.|                                 :..|||.     
Human   117 IHEDFDNNSMSNNIALLKTD---------------------------------TAMHFGNLVQSI 148

  Fly   186 ---GPFAKYPTVLQKL---DYKTLSNSKCKETMTQL-----TDTEICALERF------------G 227
               |.....|.|||..   .:...|.:....||:.|     .|.::|.|.:.            .
Human   149 CFLGRMLHTPPVLQNCWVSGWNPTSATGNHMTMSVLRKIFVKDLDMCPLYKLQKTECGSHTKEET 213

  Fly   228 KGACNGDSGGPLV--MKSGESYKQVGVVSYGTAFCASNNPD--VYTRVSMFDGWIKER 281
            |.||.||.|.|::  ::..:.:...||:::|...|    |.  :||:|..:..||..:
Human   214 KTACLGDPGSPMMCQLQQFDLWVLRGVLNFGGETC----PGLFLYTKVEDYSKWITSK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 54/266 (20%)
Tryp_SPc 47..280 CDD:238113 56/267 (21%)
PRSS54NP_001073961.1 Tryp_SPc 52..264 CDD:214473 53/260 (20%)
Tryp_SPc 52..264 CDD:238113 53/260 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147458
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.