DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43675 and ZFAND5

DIOPT Version :10

Sequence 1:NP_001027159.2 Gene:CG43675 / 14462445 FlyBaseID:FBgn0263750 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_005998.1 Gene:ZFAND5 / 7763 HGNCID:13008 Length:213 Species:Homo sapiens


Alignment Length:133 Identity:29/133 - (21%)
Similarity:49/133 - (36%) Gaps:34/133 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GPIAAGPVGLGLVTGTDRNG-----FPQHIAASK------AQATATRPAAPIPPPRSYLRAGTS- 113
            ||:... .|.|.......||     :.:|:...:      ...||:...:|.....|..||.|| 
Human    10 GPMLCS-TGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRADTSL 73

  Fly   114 ---AAPASASARLAAKVPGA--PVVGLVSH----------TGSSNISQP------PSVTKKSSLS 157
               ...|.:::..:..||.|  ||...::.          |..:.:|:|      |||::.|:..
Human    74 NNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQ 138

  Fly   158 SRK 160
            |.:
Human   139 SEE 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43675NP_001027159.2 None
ZFAND5NP_005998.1 zf-A20 12..35 CDD:460313 4/23 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..149 22/103 (21%)
ZnF_AN1 154..191 CDD:197545
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.