DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG43675 and ZFAND5

DIOPT Version :9

Sequence 1:	NP_001027159.2	Gene:	CG43675 / 14462445	FlyBaseID:	FBgn0263750	Length:	372	Species:	Drosophila melanogaster
Sequence 2:	NP_001095890.1	Gene:	ZFAND5 / 7763	HGNCID:	13008	Length:	213	Species:	Homo sapiens

Alignment Length:	133	Identity:	29/133 - (21%)
Similarity:	49/133 - (36%)	Gaps:	34/133 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly    61 GPIAAGPVGLGLVTGTDRNG-----FPQHIAASK------AQATATRPAAPIPPPRSYLRAGTS- 113
            ||:... .|.|.......||     :.:|:...:      ...||:...:|.....|..||.||
Human    10 GPMLCS-TGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRADTSL 73

  Fly   114 ---AAPASASARLAAKVPGA--PVVGLVSH----------TGSSNISQP------PSVTKKSSLS 157
               ...|.:::..:..||.|  ||...::.          |..:.:|:|      |||::.|:..
Human    74 NNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQ 138

  Fly   158 SRK 160
            |.:
Human   139 SEE 141

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG43675	NP_001027159.2	None
ZFAND5	NP_001095890.1	zf-A20	12..34	CDD:396357	4/22 (18%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	39..149		22/103 (21%)
		ZnF_AN1	154..191	CDD:197545
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165157360
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S3652
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.880