DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43675 and ZFAND6

DIOPT Version :10

Sequence 1:NP_001027159.2 Gene:CG43675 / 14462445 FlyBaseID:FBgn0263750 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_061879.2 Gene:ZFAND6 / 54469 HGNCID:30164 Length:208 Species:Homo sapiens


Alignment Length:112 Identity:27/112 - (24%)
Similarity:47/112 - (41%) Gaps:4/112 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 GTSAAPASASARLAAKVPGAPVVGLV----SHTGSSNISQPPSVTKKSSLSSRKLGGGKTTDSSI 171
            |..:.||::.:.|:..:|.....|.|    |...|::.|..||.....||.|..:...:...:|:
Human    46 GRISPPATSVSSLSESLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSV 110

  Fly   172 KRRVKFSANVHTFPSLTNTKKSTRIGELQLKKKVKKLKRIRSRREGG 218
            .:.|..:.:|....|.|..:.|....:...|.|.||.:....|::.|
Human   111 DKAVPETEDVQASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVG 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43675NP_001027159.2 None
ZFAND6NP_061879.2 zf-A20 12..35 CDD:460313
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..140 21/93 (23%)
ZnF_AN1 149..186 CDD:197545 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.