powered by:
Protein Alignment CG43675 and CG15368
DIOPT Version :9
Sequence 1: | NP_001027159.2 |
Gene: | CG43675 / 14462445 |
FlyBaseID: | FBgn0263750 |
Length: | 372 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_572541.1 |
Gene: | CG15368 / 31861 |
FlyBaseID: | FBgn0030104 |
Length: | 162 |
Species: | Drosophila melanogaster |
Alignment Length: | 67 |
Identity: | 12/67 - (17%) |
Similarity: | 24/67 - (35%) |
Gaps: | 4/67 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 280 ALRRKAKRSAEQEEKSKESIATATGSRTGKPKTKTIRKSG----GSSAKTLLASSSHLVDSRAGL 340
|..::..:..:.:...:|..:.|..|:.|.....|...|| |:.|:............:.|:
Fly 47 AQEQQQPQQQQDQPPMEEQDSRAVNSKDGAANQDTSADSGQDQDGNQAQDSTKKRCDKCGKKLGI 111
Fly 341 EG 342
.|
Fly 112 TG 113
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG43675 | NP_001027159.2 |
None |
CG15368 | NP_572541.1 |
ZnF_AN1 |
102..140 |
CDD:197545 |
2/12 (17%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45469699 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S3652 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.880 |
|
Return to query results.
Submit another query.