DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43675 and CG15368

DIOPT Version :9

Sequence 1:NP_001027159.2 Gene:CG43675 / 14462445 FlyBaseID:FBgn0263750 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_572541.1 Gene:CG15368 / 31861 FlyBaseID:FBgn0030104 Length:162 Species:Drosophila melanogaster


Alignment Length:67 Identity:12/67 - (17%)
Similarity:24/67 - (35%) Gaps:4/67 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 ALRRKAKRSAEQEEKSKESIATATGSRTGKPKTKTIRKSG----GSSAKTLLASSSHLVDSRAGL 340
            |..::..:..:.:...:|..:.|..|:.|.....|...||    |:.|:............:.|:
  Fly    47 AQEQQQPQQQQDQPPMEEQDSRAVNSKDGAANQDTSADSGQDQDGNQAQDSTKKRCDKCGKKLGI 111

  Fly   341 EG 342
            .|
  Fly   112 TG 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43675NP_001027159.2 None
CG15368NP_572541.1 ZnF_AN1 102..140 CDD:197545 2/12 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469699
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3652
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.880

Return to query results.
Submit another query.