DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43675 and F22D6.2

DIOPT Version :9

Sequence 1:NP_001027159.2 Gene:CG43675 / 14462445 FlyBaseID:FBgn0263750 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001369930.1 Gene:F22D6.2 / 172441 WormBaseID:WBGene00009050 Length:189 Species:Caenorhabditis elegans


Alignment Length:104 Identity:23/104 - (22%)
Similarity:35/104 - (33%) Gaps:38/104 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 VVGKSSPATGKSAL--------------ITALRRKAKRSAEQ-----EEKSKESIATATGSRTGK 309
            ||..||.|...|||              ::.....||...|.     ::.:.:|:..|..:   .
 Worm    51 VVSPSSMAATSSALKSEPSSVDMCMKAAVSVSDETAKMDCEDIINVCDQINDDSVTVAEST---A 112

  Fly   310 PKTKT------IRKSGGSSAKTLLASSSHLVDSRAGLEG 342
            |.|.|      ::|          |:..|:...|.||.|
 Worm   113 PTTITVDVPVPVKK----------ANRCHMCKKRVGLTG 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43675NP_001027159.2 None
F22D6.2NP_001369930.1 zf-A20 14..34 CDD:396357
ZnF_AN1 130..167 CDD:197545 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167008
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3652
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.880

Return to query results.
Submit another query.