DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43673 and CG17147

DIOPT Version :10

Sequence 1:NP_001259580.1 Gene:CG43673 / 14462401 FlyBaseID:FBgn0263748 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:228 Identity:55/228 - (24%)
Similarity:84/228 - (36%) Gaps:49/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TEALGSTVCADRFNGLS---FADPASCSSFFVCQRGNAVRRECSNGLYYDPKIQTCNLPGLVKCF 83
            |.|..:..|.:|..||.   .|||..|..:|.|..|..:...|..|.::|.:.|:| |.|:    
  Fly    79 TLANSNKYCGNRCEGLDGEWVADPTECHKYFYCMNGVPLAGMCPVGQHFDERSQSC-LYGV---- 138

  Fly    84 NGDRGGSVLGDVKANVTLV-PNGKANGEVTTTPPQTTTCPPT---TTVTPAVTTKKSKLILDTED 144
                 .|:..||.....|| .|.|...|....  ....|..|   .:.:..||:||.: ..|.|.
  Fly   139 -----DSMCVDVNNICELVAENTKFRNEKDCA--YYYECDKTGNHASKSCTVTSKKRE-YFDVES 195

  Fly   145 AD--DAHSIFQVTPHPLTNRIDVLRSQRDCRGINDGEYLTDPKHCRRFYMCHKNRVKR------- 200
            .:  :|:.: :.|.|...|         .|.......:.:|...||.:::|     |.       
  Fly   196 GNCVEANKV-ECTAHSKEN---------VCTSSTTMTFKSDQATCRGYFVC-----KALYPVADL 245

  Fly   201 ----HNCPRNQWFDRETKSCQDRELVLNCPVNR 229
                ..||...:||.:.:.|.:...|: |..||
  Fly   246 DPLWTQCPEGYFFDEDRQLCANPTTVV-CTHNR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43673NP_001259580.1 CBM_14 30..82 CDD:426342 18/54 (33%)
CBM_14 172..225 CDD:426342 12/63 (19%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696
ChtBD2 89..136 CDD:214696 15/47 (32%)
CBM_14 278..332 CDD:426342 55/228 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.