DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43673 and CG34324

DIOPT Version :9

Sequence 1:NP_001259580.1 Gene:CG43673 / 14462401 FlyBaseID:FBgn0263748 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster


Alignment Length:127 Identity:55/127 - (43%)
Similarity:69/127 - (54%) Gaps:13/127 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 TTTPPQTTT--C-PPTTTVTPAVTTKKSKLILDTEDADDAHSIFQVTPH--PLTNRI---DVLRS 168
            |.|||.|||  | ||.||..|..||     :..|..:|:|..|......  .:.|.:   .||.|
  Fly   146 TRTPPCTTTPPCTPPCTTTKPCTTT-----VCTTPKSDNAGPIVDGNEEQPDIDNPVAIAQVLIS 205

  Fly   169 QRDCRGINDGEYLTDPKHCRRFYMCHKNRVKRHNCPRNQWFDRETKSCQDRELVLNCPVNRN 230
            :.||||..||.:|.|.:||||:|:|::.|.||.|||...|||||.|:|:....|.||...||
  Fly   206 RHDCRGQEDGTFLADVRHCRRYYVCNRQRSKRQNCPNGYWFDRELKACRLASTVNNCDARRN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43673NP_001259580.1 CBM_14 30..82 CDD:279884
CBM_14 172..225 CDD:279884 27/52 (52%)
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884 27/52 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I18955
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019652
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.