DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43673 and CG34324

DIOPT Version :10

Sequence 1:NP_001259580.1 Gene:CG43673 / 14462401 FlyBaseID:FBgn0263748 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster


Alignment Length:127 Identity:55/127 - (43%)
Similarity:69/127 - (54%) Gaps:13/127 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 TTTPPQTTT--C-PPTTTVTPAVTTKKSKLILDTEDADDAHSIFQVTPH--PLTNRI---DVLRS 168
            |.|||.|||  | ||.||..|..||     :..|..:|:|..|......  .:.|.:   .||.|
  Fly   146 TRTPPCTTTPPCTPPCTTTKPCTTT-----VCTTPKSDNAGPIVDGNEEQPDIDNPVAIAQVLIS 205

  Fly   169 QRDCRGINDGEYLTDPKHCRRFYMCHKNRVKRHNCPRNQWFDRETKSCQDRELVLNCPVNRN 230
            :.||||..||.:|.|.:||||:|:|::.|.||.|||...|||||.|:|:....|.||...||
  Fly   206 RHDCRGQEDGTFLADVRHCRRYYVCNRQRSKRQNCPNGYWFDRELKACRLASTVNNCDARRN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43673NP_001259580.1 CBM_14 30..82 CDD:426342
CBM_14 172..225 CDD:426342 27/52 (52%)
CG34324NP_001096972.1 CBM_14 209..262 CDD:426342 27/52 (52%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.