DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gas6 and drpr

DIOPT Version :9

Sequence 1:NP_062394.2 Gene:Gas6 / 14456 MGIID:95660 Length:674 Species:Mus musculus
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:235 Identity:64/235 - (27%)
Similarity:84/235 - (35%) Gaps:84/235 - (35%)


- Green bases have known domain annotations that are detailed below.


Mouse   109 CVQNLPD-----QCTPN-PCDKKGTHICQDLMGNFFCVCTDGWGGRLCDKDVNEC-VQKNG-GCS 165
            |....||     ||..: ||...|.  ||...|  .|:|..||.|.:|   .|:| |...| ||.
  Fly   214 CDMRCPDGKHGAQCQQDCPCQNDGK--CQPETG--ACMCNPGWTGDVC---ANKCPVGSYGPGCQ 271

Mouse   166 Q--------VCHNKPGSFQCACHSGFSLASDGQTCQDIDEC-------TDSDTC---GDARCKNL 212
            :        .||:..|  ||.|..|:.    |:.|  .|||       ..|.||   .||.|...
  Fly   272 ESCECYKGAPCHHITG--QCECPPGYR----GERC--FDECQLNTYGFNCSMTCDCANDAMCDRA 328

Mouse   213 PGSYSCLCDEGYTYSS-KEKTCQ------------------------DVDECQ------QDRCEQ 246
            .|  :|:|:.|:|.:. .|:.|:                        :...||      ..:|.:
  Fly   329 NG--TCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTR 391

Mouse   247 TCV---NSPG-SYTCHCDGRGGLKLSPDMDTCEDILPCVP 282
            .|.   ..|. ..||:|  :.|.|.||...||    .|.|
  Fly   392 PCTFLRYGPNCELTCNC--KNGAKCSPVNGTC----LCAP 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gas6NP_062394.2 GLA 26..90 CDD:214503
EGF_CA 115..150 CDD:238011 14/40 (35%)
FXa_inhibition 157..192 CDD:291342 13/44 (30%)
EGF_CA 194..225 CDD:214542 13/40 (33%)
cEGF 215..238 CDD:289433 6/47 (13%)
FXa_inhibition 244..274 CDD:291342 10/33 (30%)
LamG 295..447 CDD:238058
Laminin_G_2 510..647 CDD:280389
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395 15/52 (29%)
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24035
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.