DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galr1 and AstA-R2

DIOPT Version :9

Sequence 1:NP_032108.1 Gene:Galr1 / 14427 MGIID:1096364 Length:348 Species:Mus musculus
Sequence 2:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster


Alignment Length:314 Identity:112/314 - (35%)
Similarity:171/314 - (54%) Gaps:17/314 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse    40 FGLIFAMGVLGNSLVITVLARSKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLG 104
            ||:|...|..||.|||.|:..:  ...||||||.|:||:.|||.:::.||||.||.|.:..|..|
  Fly    45 FGVIAITGFFGNLLVILVVVFN--NNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYYWPYG 107

Mouse   105 AFICKFIHYFFTVSMLVSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGFIWALSIAMASP 169
            .|.|:.:.|...|:...||:||..||:||::|:||..||..:|.....|:.:..:|.:.:.::.|
  Fly   108 RFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVVLVVSVP 172

Mouse   170 VAY-HQRLFHRDS--NQTF--CWEQWPNKLHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKK 229
            ||: |..:...|:  |.|:  |.....:.|..:.|.|..|:..|||||::|...|.:::..|.::
  Fly   173 VAFTHDVVVDYDAKKNITYGMCTFTTNDFLGPRTYQVTFFISSYLLPLMIISGLYMRMIMRLWRQ 237

Mouse   230 LK--NMSKKSEASKKKTAQTVLVVVVVFGISWLPHHVVHLWAEFGAFPL-TPASFFFRITAHCLA 291
            ..  .|||:|:..:|:..:.|:|||:.|...|||..::.|......... |......::||..||
  Fly   238 GTGVRMSKESQRGRKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVIQVTAQTLA 302

Mouse   292 YSNSSVNPIIYAFLSENFRKAYKQVFKCHVCDESPRSETKENKSRMDTPPSTNC 345
            ||:|.:||::|||||||||||:.:...|       .|..:...|.:..|..|:|
  Fly   303 YSSSCINPLLYAFLSENFRKAFYKAVNC-------SSRYQNYTSDLPPPRKTSC 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Galr1NP_032108.1 7tm_1 50..302 CDD:278431 91/259 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..348 5/18 (28%)
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 48/118 (41%)
7tm_1 55..313 CDD:278431 91/259 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 180 1.000 Domainoid score I3486
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I3654
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1294084at2759
OrthoFinder 1 1.000 - - FOG0000972
OrthoInspector 1 1.000 - - mtm8885
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1132
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.