DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fzd6 and Corin

DIOPT Version :9

Sequence 1:NP_001155966.1 Gene:Fzd6 / 14368 MGIID:108474 Length:709 Species:Mus musculus
Sequence 2:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster


Alignment Length:196 Identity:56/196 - (28%)
Similarity:79/196 - (40%) Gaps:30/196 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse    23 TCEPITVPRCM--KMTYNMTFFPNLMGHYDQGIAAVEMGHFLHLANLECSPNIEMFLCQAFIPTC 85
            ||.||.|..|.  ::.||.|.|||.:||:.|.....::..:..|.::.|...:.:|||..|:|.|
  Fly   778 TCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLFVPKC 842

Mouse    86 TEQIHVVLPCRKLCEKIVSDCKKLMDTFGIRWPEELEC---NRLPHCDDTVPVTSHPHTELSGPQ 147
            .:....|.||:.||.:.:..|....|.||:..||.|.|   ...|..:|.|.:........:...
  Fly   843 GQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSEDCVGLDEVREVMRAATH 907

Mouse   148 KKSDQVPRDIGFWCPKHLRTSGDQGYRFLGIEQCAPP---CPNMYFKSDELDFAK-SFIGIVSIF 208
            .|.|      ||.|        ||       .:|.|.   |.......|:.|.|| ...|...|:
  Fly   908 PKCD------GFQC--------DQ-------NRCLPQEYVCDGHLDCMDQADEAKCERCGPDEIY 951

Mouse   209 C 209
            |
  Fly   952 C 952

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fzd6NP_001155966.1 CRD_FZ6 20..146 CDD:143559 39/127 (31%)
7tmF_FZD6 188..508 CDD:320160 7/23 (30%)
TM helix 1 198..222 CDD:320160 5/13 (38%)
TM helix 2 231..252 CDD:320160
TM helix 3 283..305 CDD:320160
TM helix 4 326..342 CDD:320160
TM helix 5 364..387 CDD:320160
TM helix 6 418..440 CDD:320160
TM helix 7 469..494 CDD:320160
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 498..503
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 583..709
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 38/115 (33%)
LDLa 911..942 CDD:238060 12/51 (24%)
LDLa 945..979 CDD:238060 3/8 (38%)
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.