DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBQLNL and CG31528

DIOPT Version :9

Sequence 1:NP_659490.4 Gene:UBQLNL / 143630 HGNCID:28294 Length:475 Species:Homo sapiens
Sequence 2:NP_730833.1 Gene:CG31528 / 318785 FlyBaseID:FBgn0051528 Length:344 Species:Drosophila melanogaster


Alignment Length:399 Identity:86/399 - (21%)
Similarity:145/399 - (36%) Gaps:130/399 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    33 VIVKTAGNQKDFMVADDISVRQFKEMLLAHFQCQMDQLVLVFMGCLLKDHDTLSQRGIMDGHTIY 97
            :..|.:|..:...:..:..:|..:.::...|:..:.:::|||.|.:|.|..|:..|||:.|.|::
  Fly     9 ICAKGSGRVETVTLRQNELIRNLRVLVAVRFEQAISRIILVFAGQVLSDEGTIDSRGIVSGVTVH 73

Human    98 LVI-----------------KSKQGSRSL-----AH---------SFRDLPTNDPCHRDRNTKGN 131
            :|.                 :||...|.:     ||         ..|.|...||          
  Fly    74 VVCR
AEAANSPSPTPIAATKRSKPSERLMRSWQSAHIAFLQQEPDVLRSLLQADP---------- 128

Human   132 SSRVHQPTGMNQAPVELAHFVGSDAPKVHTQNLEVSHPECKAQMLE---NPSIQRL-------LS 186
              |:......|.|   :.|::.||      |||.        :||.   :|:.|.|       :|
  Fly   129 --RIRSLLDENAA---MRHYLNSD------QNLR--------EMLSLAFSPAKQELGRRRDLHIS 174

Human   187 NMEFMWQFISEHLDTQQLMQQNPEVSRLLLDNSEILLQTLELARNLAMIQEIMQIQQPSQNLEYP 251
            .|||:                 |...::|...:..:||..|  .|:|     |..||.||..:..
  Fly   175 RMEFV-----------------PGGYKVLSRLNYCMLQAYE--DNVA-----MAFQQASQGAKTS 215

Human   252 LNPQPYLGLETMPGGNNALGQNYADINDQMLNS-MQDPFGGNPFTALLAGQV---LEQVQSSPPP 312
            .|||  .|||               :.|.:.|. ::.|...||.|..|..:|   ...|:.|.|.
  Fly   216 SNPQ--RGLE---------------VKDPLPNPWLRMPRIRNPRTCALPRRVNKGRSSVKQSDPN 263

Human   313 PPPSQEQQDQLTQHPATRVIYNS--SGG-------FSSNTSANDTLNKVNHTSKANT--AMISTK 366
            ....|:...::....||:.....  |||       :.|..   :.|.::.:::::..  |::.:.
  Fly   264 ADCRQKSSSKVMTSTATQTKCKDRRSGGDGHCQHCYQSQV---EQLTQMGYSNRSRNKRALLISL 325

Human   367 GQSHICATR 375
            |... ||.|
  Fly   326 GNVD-CAVR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBQLNLNP_659490.4 UBQ 32..101 CDD:214563 17/84 (20%)
UBQ 32..101 CDD:294102 17/84 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..138 5/24 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..325 4/19 (21%)
CG31528NP_730833.1 UBQ 7..77 CDD:294102 17/67 (25%)
UBA_like_SF 299..335 CDD:304366 7/39 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148236
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1553668at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10677
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.