| Sequence 1: | NP_067432.2 | Gene: | Fzd1 / 14362 | MGIID: | 1196625 | Length: | 642 | Species: | Mus musculus |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_610297.2 | Gene: | Corin / 35691 | FlyBaseID: | FBgn0033192 | Length: | 1397 | Species: | Drosophila melanogaster |
| Alignment Length: | 211 | Identity: | 56/211 - (26%) |
|---|---|---|---|
| Similarity: | 83/211 - (39%) | Gaps: | 48/211 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Mouse 106 PDHGYCQPISIPLC--TDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMY 168
Mouse 169 APVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTP 233
Mouse 234 TPSLLPEF-----WTSNPQHGGGGYRGGYPGGAGTVERGKFSCPRALRVPSYLNYHFLGEKDC-- 291
Mouse 292 ---GAPCE---PTKVY 301 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Fzd1 | NP_067432.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 26..45 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 76..99 | ||||
| CRD_FZ1 | 107..233 | CDD:143574 | 39/127 (31%) | ||
| 7tmF_FZD1 | 294..641 | CDD:320375 | 4/11 (36%) | ||
| TM helix 1 | 313..338 | CDD:320375 | |||
| TM helix 2 | 347..368 | CDD:320375 | |||
| TM helix 3 | 398..424 | CDD:320375 | |||
| TM helix 4 | 441..457 | CDD:320375 | |||
| TM helix 5 | 479..508 | CDD:320375 | |||
| TM helix 6 | 528..555 | CDD:320375 | |||
| TM helix 7 | 591..616 | CDD:320375 | |||
| Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 | 620..625 | ||||
| PDZ-binding | 640..642 | ||||
| Corin | NP_610297.2 | CRD_FZ | 778..894 | CDD:143549 | 36/115 (31%) |
| LDLa | 911..942 | CDD:238060 | 9/50 (18%) | ||
| LDLa | 945..979 | CDD:238060 | 2/7 (29%) | ||
| SR | 980..>1034 | CDD:214555 | |||
| SRCR | 992..1086 | CDD:278931 | |||
| Tryp_SPc | 1103..1343 | CDD:214473 | |||
| Tryp_SPc | 1104..1346 | CDD:238113 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||