DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSF1R and htl

DIOPT Version :10

Sequence 1:NP_005202.2 Gene:CSF1R / 1436 HGNCID:2433 Length:972 Species:Homo sapiens
Sequence 2:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster


Alignment Length:138 Identity:28/138 - (20%)
Similarity:53/138 - (38%) Gaps:47/138 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   787 KIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAVPGADIKVLINFNAPNPQDRKKF 851
            |:.:.:|.     .|:.|..|.:::|:.....|         :|.|...::..|..|:|:    :
  Fly    31 KLTEPRKR-----MREDFGYYEIRLLVLTQLGY---------IPVAAAMLMTAFMEPSPE----W 77

Human   852 TDDLRESVAEVQEMEKHRIESELEKQKGVVRPSMSQCSSLKKESGNGTLSRACLDDSYASGEGLK 916
            .|.:||:                 :|...:.|: ::..||..|.|     .||..:|.      :
  Fly    78 CDTVRET-----------------EQSWKLNPN-NEFYSLSVERG-----FACQKNSN------Q 113

Human   917 RSALSSSL 924
            .:|:.|||
  Fly   114 TTAMMSSL 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSF1RNP_005202.2 IG_like 28..85 CDD:214653
Ig strand B 38..42 CDD:409353
Ig strand C 55..58 CDD:409353
Ig strand E 66..71 CDD:409353
Ig strand F 81..86 CDD:409353
Ig strand G 94..97 CDD:409353
IgI_3_CSF-1R 203..295 CDD:409530
Ig strand A 203..208 CDD:409530
Ig strand A' 210..216 CDD:409530
Ig strand B 220..228 CDD:409530
Ig strand C 234..238 CDD:409530
Ig strand C' 241..244 CDD:409530
Ig strand D 248..253 CDD:409530
Ig strand E 257..265 CDD:409530
Ig strand F 274..282 CDD:409530
Ig strand G 285..295 CDD:409530
IgI_4_SCFR_like 299..400 CDD:409364
Ig strand A 299..305 CDD:409364
Ig strand A' 309..314 CDD:409364
Ig strand B 317..327 CDD:409364
Ig strand C 331..338 CDD:409364
Ig strand C' 340..343 CDD:409364
Ig strand D 347..352 CDD:409364
Ig strand E 361..370 CDD:409364
Ig strand F 377..385 CDD:409364
Ig strand G 388..399 CDD:409364
Ig_3 401..489 CDD:464046
Regulatory juxtamembrane domain 542..574
PTKc_CSF-1R 543..914 CDD:133237 24/126 (19%)
Activation loop 796..818 4/21 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..950 4/7 (57%)
htlNP_524394.2 Ig 101..191 CDD:472250 9/32 (28%)
Ig strand B 121..125 CDD:409353 1/1 (100%)
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.