DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fut7 and FucTA

DIOPT Version :9

Sequence 1:XP_011237324.1 Gene:Fut7 / 14347 MGIID:107692 Length:438 Species:Mus musculus
Sequence 2:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster


Alignment Length:306 Identity:91/306 - (29%)
Similarity:143/306 - (46%) Gaps:57/306 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse   160 PGDTCTRYGMASCRLSANRSLLASADAVVFHHRELQTRQSLLPLDQRPHGQPWVWASM----ESP 220
            |.||        |.|:|||.|.::||.:::....:.|.      .:||.....|  ||    |.|
  Fly   201 PVDT--------CELTANRDLASTADMILYKDHYIPTG------IRRPSNSKQV--SMLYYLECP 249

Mouse   221 SNTHGLHRFRGIFNWVLSYRRDSDIFVPY-------GRLEPLSGPTSPLPAKSRMAAWVISNFQE 278
            .:|..: :.....||..:|||||.|..||       .:::......:....|::..||.:||...
  Fly   250 YHTQNV-KVPDAINWTATYRRDSTIVAPY
EKWQYYDTKVQQQEQDINYSVNKTKKVAWFVSNCGA 313

Mouse   279 RQQRAKLYRQLAPHLQVDVFGRASGRPLCAN--CLLPTLAR--------YRFYLAFENSQHRDYI 333
            |..|.:...:|..:::||::|      .|.|  |...|..:        |:||||||||..:|||
  Fly   314 RNGRLQYAHELQKYIEVDIYG------ACGNFKCSRSTADKCFEILDNDYKFYLAFENSNCKDYI 372

Mouse   334 TEKFWRNALAAGAVPVALGPPRATYEAFVPPDAFVHVDDFSSARELAVFL--VSMNESRYRGFFA 396
            ||||:.|||....:|:.:|.....||...|..:::|||:|||.:|||.:|  :..::..|..:|.
  Fly   373 TEKFFVNALNRRVLPIVMGARPEDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHDDELYNSYFK 437

Mouse   397 WRDRLRVRLLGDWRERF--CTICA---RYPYLPRSQVYEDLESWFQ 437
            |:.      .|::...:  |.:||   ....|.:.:.|.||..|::
  Fly   438 WKG------TGEFINTYYWCRVCATLHNEEQLRKPRWYTDLNDWWR 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fut7XP_011237324.1 Glyco_tran_10_N 140..250 CDD:374959 30/100 (30%)
Glyco_transf_10 265..433 CDD:366335 59/184 (32%)
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 28/92 (30%)
Glyco_transf_10 300..473 CDD:279224 59/184 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6052
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 1 1.000 - - mtm8745
orthoMCL 1 0.900 - - OOG6_100170
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3232
SonicParanoid 1 1.000 - - X114
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.800

Return to query results.
Submit another query.