DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ftl1 and Fer1HCH

DIOPT Version :9

Sequence 1:NP_034370.2 Gene:Ftl1 / 14325 MGIID:95589 Length:183 Species:Mus musculus
Sequence 2:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster


Alignment Length:185 Identity:48/185 - (25%)
Similarity:92/185 - (49%) Gaps:21/185 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse     4 QIRQNYSTEVEAAVNRLVNL---HLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAER 65
            :|.:::....:|.:..:.|.   .:.|||.||::|.:|.||.|...|....|.:.|:|:||...:
  Fly    69 EITKDWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSK 133

Mouse    66 LLEFQNDRG----GRALFQDVQKPSQDEWGKTQEAMEAALAMEKNLNQALLDLHALGSARADP-- 124
            |:|:.:.||    |.:...:|...::.||.....|:..||.:|..:.:::..|  :.:....|  
  Fly   134 LVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKL--IQTCENKPYN 196

Mouse   125 --HLCDFLESHYLDKEVKLIKKMGNHLTNLRRVAGPQPAQTGAPQGSLGEYLFER 177
              ||.|:|...||::::...:::...||.|:::..        ..|.|||:||::
  Fly   197 HYHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMD--------TNGELGEFLFDK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ftl1NP_034370.2 Ferritin 10..177 CDD:153098 47/177 (27%)
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 47/173 (27%)
Ferritin 82..229 CDD:278632 40/148 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.