DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPK14 and mapk14

DIOPT Version :9

Sequence 1:XP_011512612.2 Gene:MAPK14 / 1432 HGNCID:6876 Length:401 Species:Homo sapiens
Sequence 2:NP_001005824.1 Gene:mapk14 / 448296 XenbaseID:XB-GENE-1018617 Length:361 Species:Xenopus tropicalis


Alignment Length:337 Identity:296/337 - (87%)
Similarity:312/337 - (92%) Gaps:8/337 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    65 AGMRSTVCSTQVRCESAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLD 129
            :|...:|||        ||||:|.|||||||||||||||||||||||||||||||||||||||||
 Frog    33 SGAYGSVCS--------AFDTRTELRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLD 89

Human   130 VFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKP 194
            |||||:|.||||||||||||||||||||||||||||||||||||||||||||||||.||||||||
 Frog    90 VFTPAKSFEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSAGIIHRDLKP 154

Human   195 SNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLT 259
            |||||||||||||||||||||||:|||||||||||||||||||||||||||||||||||||||||
 Frog   155 SNLAVNEDCELKILDFGLARHTDEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLT 219

Human   260 GRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVD 324
            ||||||||||||||||||||||||..|||:|||||:||||||||..||||||.:||:||||.|||
 Frog   220 GRTLFPGTDHIDQLKLILRLVGTPEPELLQKISSEAARNYIQSLPYMPKMNFEDVFLGANPQAVD 284

Human   325 LLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISF 389
            |||||||||:|||||||:||||.||||||||||||:|:|||||||||:|.|:|||.|||:|||.|
 Frog   285 LLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDEPIAEPYDQSFESRELDIEEWKRLTYEEVICF 349

Human   390 VPPPLDQEEMES 401
            ||||||.|||||
 Frog   350 VPPPLDSEEMES 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPK14XP_011512612.2 None
mapk14NP_001005824.1 STKc_p38alpha 7..351 CDD:143382 285/325 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 527 1.000 Domainoid score I3300
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H31777
Inparanoid 1 1.050 653 1.000 Inparanoid score I5836
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D160292at32523
OrthoFinder 1 1.000 - - FOG0000533
OrthoInspector 1 1.000 - - oto150780
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X352
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.