DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPK14 and p38a

DIOPT Version :9

Sequence 1:XP_011512612.2 Gene:MAPK14 / 1432 HGNCID:6876 Length:401 Species:Homo sapiens
Sequence 2:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster


Alignment Length:310 Identity:226/310 - (72%)
Similarity:258/310 - (83%) Gaps:3/310 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    87 TGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTP---ARSLEEFNDVYLVTH 148
            |.:.||:|||:|||||.:|||||||||||||||.|||||||||:|.|   ..|||.|..||||||
  Fly    47 TNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTH 111

Human   149 LMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLA 213
            ||.||||||::.|.|:|||||||:|||||||||||||.:|||||||||:||||||||:|||||||
  Fly   112 LMDADLNNIIRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLA 176

Human   214 RHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILR 278
            |.|::|||||||||||||||||||||||:|||||||||||||||:|.||||||||||.||.||:.
  Fly   177 RPTENEMTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIME 241

Human   279 LVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQA 343
            ::|||.||.||||||||||:|||||..|...:|.|||..|||||:|||||||.||::|||||.:|
  Fly   242 MLGTPPAEFLKKISSESARSYIQSLPPMKGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEA 306

Human   344 LAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP 393
            |:|.|..:|.:|..|..:.|||.|||..||.:|:||.|.|.||.:|.|||
  Fly   307 LSHPYLEKYAEPSVEQTSPPYDHSFEDMDLPVDKWKELIYKEVTNFKPPP 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPK14XP_011512612.2 None
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 223/306 (73%)
S_TKc 25..312 CDD:214567 203/264 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 453 1.000 Domainoid score I508
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31777
Inparanoid 1 1.050 523 1.000 Inparanoid score I1260
Isobase 1 0.950 - 0 Normalized mean entropy S378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D324618at33208
OrthoFinder 1 1.000 - - FOG0000533
OrthoInspector 1 1.000 - - mtm8496
orthoMCL 1 0.900 - - OOG6_102675
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X352
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.