DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPK14 and rl

DIOPT Version :9

Sequence 1:XP_011512612.2 Gene:MAPK14 / 1432 HGNCID:6876 Length:401 Species:Homo sapiens
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:316 Identity:158/316 - (50%)
Similarity:221/316 - (69%) Gaps:9/316 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    81 AAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYL 145
            :|.||.|..|||:||:| ||:...:.:||.||:.:|...||||:|.:.|:.. ..|:::..|||:
  Fly    54 SADDTLTNQRVAIKKIS-PFEHQTYCQRTLREITILTRFKHENIIDIRDILR-VDSIDQMRDVYI 116

Human   146 VTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDF 210
            |..||..||..::|.|:|::||:.:.:|||||||||||||:::|||||||||.:|:.|:|||.||
  Fly   117 VQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDF 181

Human   211 GLARHTDDE------MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDH 269
            ||||..|.|      :|.|||||||||||||||...|.:::||||||||:||:|:.|.:|||..:
  Fly   182 GLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHY 246

Human   270 IDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDS 334
            :|||..||.::|:|..:.|:.|.:|.||||::||...|.:.:|.:|..|:.||:|||.|||..:.
  Fly   247 LDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNP 311

Human   335 DKRITAAQALAHAYFAQYHDPDDEPVAD-PYDQSFESRDLLIDEWKSLTYDEVISF 389
            .|||...:||||.|..||:||.|||||: |:..:.|:.|:..|..|||.::|.:.|
  Fly   312 HKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLIFEETLKF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPK14XP_011512612.2 None
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 157/313 (50%)
S_TKc 38..326 CDD:214567 139/273 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.