DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Fosl1 and CrebB

DIOPT Version :9

Sequence 1:	NP_034365.1	Gene:	Fosl1 / 14283	MGIID:	107179	Length:	273	Species:	Mus musculus
Sequence 2:	NP_001334685.1	Gene:	CrebB / 32817	FlyBaseID:	FBgn0265784	Length:	331	Species:	Drosophila melanogaster

Alignment Length:	60	Identity:	20/60 - (33%)
Similarity:	35/60 - (58%)	Gaps:	3/60 - (5%)

- Green bases have known domain annotations that are detailed below.

Mouse   100 ISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKE 159
            |:.::..:|.:|.::|:.||.:||.::||....|:.....||::...|   ||||:..||
  Fly   267 IAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKAL---IEELKSLKE 323

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Fosl1	NP_034365.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..46
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	60..114		3/13 (23%)
		Basic motif. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	107..127		7/19 (37%)
		bZIP_Fos	115..168	CDD:269869	17/45 (38%)
		coiled coil	115..167	CDD:269869	17/45 (38%)
		Leucine-zipper. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	133..161		10/27 (37%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	169..273
CrebB	NP_001334685.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R103
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.940