powered by:
Protein Alignment Fosl1 and CrebB
DIOPT Version :9
Sequence 1: | NP_034365.1 |
Gene: | Fosl1 / 14283 |
MGIID: | 107179 |
Length: | 273 |
Species: | Mus musculus |
Sequence 2: | NP_001334685.1 |
Gene: | CrebB / 32817 |
FlyBaseID: | FBgn0265784 |
Length: | 331 |
Species: | Drosophila melanogaster |
Alignment Length: | 60 |
Identity: | 20/60 - (33%) |
Similarity: | 35/60 - (58%) |
Gaps: | 3/60 - (5%) |
- Green bases have known domain annotations that are detailed below.
Mouse 100 ISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKE 159
|:.::..:|.:|.::|:.||.:||.::||....|:.....||::...| ||||:..||
Fly 267 IAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKAL---IEELKSLKE 323
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R103 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.940 |
|
Return to query results.
Submit another query.