Sequence 1: | NP_032062.1 | Gene: | Fosb / 14282 | MGIID: | 95575 | Length: | 338 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001027577.2 | Gene: | kay / 3772082 | FlyBaseID: | FBgn0001297 | Length: | 755 | Species: | Drosophila melanogaster |
Alignment Length: | 418 | Identity: | 105/418 - (25%) |
---|---|---|---|
Similarity: | 143/418 - (34%) | Gaps: | 160/418 - (38%) |
- Green bases have known domain annotations that are detailed below.
Mouse 44 CAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQ------GQPLASQPPAVDPYD---- 98
Mouse 99 ------------MPGTSY--------STPG---------LSAYSTGGASGSGGPSTSTTTSGPVS 134
Mouse 135 ARPARARPRRPREET-LTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELE 198
Mouse 199 SEIAELQKEKERLEFVLVAHKPGC-KIPYE---------------------EGPGPGP------- 234
Mouse 235 -----------------------------------LAEVRDLP------GSTSAKEDGFGWLLPP 258
Mouse 259 PPPPPLPFQSSRDAPPNLTASLFTHSEVQVLGDPFPVVSPSYTSSFVLTCPEVSAFAGAQRTSGS 323
Mouse 324 EQP--------------SDPLNSPSLLA 337 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fosb | NP_032062.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..54 | 3/9 (33%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 80..179 | 47/138 (34%) | |||
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 157..182 | 17/24 (71%) | |||
bZIP_Fos | 165..218 | CDD:269869 | 22/52 (42%) | ||
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 183..211 | 9/27 (33%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 222..276 | 17/123 (14%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 316..338 | 9/36 (25%) | |||
kay | NP_001027577.2 | bZIP_Fos | 420..481 | CDD:269869 | 29/60 (48%) |
coiled coil | 421..480 | CDD:269869 | 28/58 (48%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1414 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm44334 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23351 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
5 | 4.870 |