DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fos and CrebB

DIOPT Version :9

Sequence 1:NP_034364.1 Gene:Fos / 14281 MGIID:95574 Length:380 Species:Mus musculus
Sequence 2:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster


Alignment Length:211 Identity:42/211 - (19%)
Similarity:76/211 - (36%) Gaps:66/211 - (31%)


- Green bases have known domain annotations that are detailed below.


Mouse    38 SSMGSPVNTQDFCADLSVSSANFI---PTVTAISTSP----DLQWLVQPTLVSSVAP-------- 87
            ::.|:....|...|..::....::   |..|.|.|:|    .::..:.||....:.|        
  Fly   115 TAAGTQQQQQALAAATAMQKVVYVAKPPNSTVIHTTPGNAVQVRNKIPPTFPCKIKPEPNTQHPE 179

Mouse    88 ----------SQ------TRAPHPYGLPTQSAG------------AYARAGMVKTVSGGRAQSIG 124
                      ||      ||.|....:.|:.:|            ....:.:..|.:||.|.:  
  Fly   180 DSDESLSDDDSQHHRSELTRRPSYNKIFTEISGPDMSGASLPMSDGVLNSQLAGTGAGGNAAN-- 242

Mouse   125 RRGKVEQLSP-------------------EEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETD 170
              ..:.||.|                   ::..||.||.::|:.||.:||.:::|....|:....
  Fly   243 --SSLMQLDPTYYLSNRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVA 305

Mouse   171 QLEDEKSALQTEIANL 186
            .||::..||..|:.:|
  Fly   306 VLENQNKALIEELKSL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FosNP_034364.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..141 7/42 (17%)
Basic motif, required for the activation of phospholipid synthesis, but not for CDS1-binding 139..159 9/19 (47%)
bZIP_Fos 147..200 CDD:269869 13/40 (33%)
coiled coil 147..199 CDD:269869 13/40 (33%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 165..193 7/22 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..380
CrebBNP_001334685.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.