DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP19 and CG10089

DIOPT Version :10

Sequence 1:NP_543152.1 Gene:DUSP19 / 142679 HGNCID:18894 Length:217 Species:Homo sapiens
Sequence 2:NP_648654.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster


Alignment Length:146 Identity:43/146 - (29%)
Similarity:81/146 - (55%) Gaps:1/146 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    69 IKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECF 133
            :.|.|.:|:...:.|...|::.|::||:.: :......|.|..|..:...|.|:.|:..||..|.
  Fly     8 VLPGLYVGNYRDSKDHAQLERFKISHIIAI-HDSPRRLLPDKHYLCVMASDTPDQNLSQYFSVCN 71

Human   134 EFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLR 198
            :||..|:.::|.||:||.||:||:..:.:.::|.:...::..|..:|:..|....||:||..||:
  Fly    72 DFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQ 136

Human   199 TYQEGKESNKCDRIQE 214
            .:::.|.|.:..|::|
  Fly   137 EFEQFKLSEERRRLRE 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP19NP_543152.1 DSP_DUSP19 65..201 CDD:350373 39/131 (30%)
CG10089NP_648654.1 DSP_DUSP22_15 5..140 CDD:350369 39/132 (30%)

Return to query results.
Submit another query.