DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MIB2 and ref(2)P

DIOPT Version :10

Sequence 1:XP_047302550.1 Gene:MIB2 / 142678 HGNCID:30577 Length:1267 Species:Homo sapiens
Sequence 2:NP_476700.1 Gene:ref(2)P / 35246 FlyBaseID:FBgn0003231 Length:599 Species:Drosophila melanogaster


Alignment Length:63 Identity:21/63 - (33%)
Similarity:29/63 - (46%) Gaps:6/63 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   320 SGTRARAPTTAPATRARTTCCCVRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKH 382
            |...|.||:....:....      |..:.||.|....|.|.|:||..|.:||||.:|.:.:||
  Fly   104 SSANAEAPSVDDPSNFTI------HDAVECDGCGLAPLIGFRYKCVQCSNYDLCQKCELAHKH 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MIB2XP_047302550.1 PHA03247 <6..337 CDD:223021 4/16 (25%)
ZZ_Mind_bomb 347..391 CDD:239079 16/36 (44%)
MIB_HERC2 418..482 CDD:461991
SH3_15 515..580 CDD:465720
SH3_15 607..671 CDD:465720
ANKYR 678..947 CDD:440430
ANK repeat 744..774 CDD:293786
ANK repeat 776..807 CDD:293786
ANK repeat 809..840 CDD:293786
ANK repeat 842..876 CDD:293786
ANK repeat 879..910 CDD:293786
ANK repeat 912..944 CDD:293786
Ank_2 917..993 CDD:463710
ANK repeat 946..977 CDD:293786
RING-HC_MIB2_rpt1 1142..1179 CDD:438386
RING_Ubox 1217..1267 CDD:473075
ref(2)PNP_476700.1 PB1 6..88 CDD:413452
ZZ 121..165 CDD:395451 17/46 (37%)
UBA_SQSTM 555..593 CDD:270505
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.