DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Flt4 and drpr

DIOPT Version :9

Sequence 1:NP_032055.1 Gene:Flt4 / 14257 MGIID:95561 Length:1363 Species:Mus musculus
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:290 Identity:63/290 - (21%)
Similarity:90/290 - (31%) Gaps:98/290 - (33%)


- Green bases have known domain annotations that are detailed below.


Mouse   427 KEASSPSIYSRHSRQTLTCTAYGV----PQPLSVQWHWRPWTPCKTFAQRSLRRRQQRDGMPQCR 487
            |:...|:|..|..       .|.|    .:..|.|.....|  |.||.             |:|.
  Fly    21 KDLDGPNICKRRE-------LYNVDVVYTELQSFQERGSTW--CVTFP-------------PRCS 63

Mouse   488 DWKEVTTQDAVNPIESLDSWTEFVEGKNKTVSKLVIQ----DANVSAMYKCVV-VNKVGQDERLI 547
            .::  .....||              |.||::|..|.    |..:::..:||. .::..|..|.|
  Fly    64 TYR--IKHRVVN--------------KTKTIAKNRIVRDCCDGYIASAGECVPHCSEPCQHGRCI 112

Mouse   548 YFYVTTIPDGFSIESEPSEDPLEGQSVRLSCRADNYTYEHLRWYRLNLSTLHDAQGNPLLLDCKN 612
                       |.|....:....|.:..::|...        ||..|.|         :..||.|
  Fly   113 -----------SPEKCKCDHGYGGPACDINCPPG--------WYGRNCS---------MQCDCLN 149

Mouse   613 VHLFATPLEANLEEAE--PGARHATLSLNIPRVAPEDEGDYVCEVQDRRSQDKHCHKKYLSVQAL 675
             :....|...:.|.|:  .|||.|.       :.||......|..:.|......||  ::|.:..
  Fly   150 -NAVCEPFSGDCECAKGYTGARCAD-------ICPEGFFGANCSEKCRCENGGKCH--HVSGECQ 204

Mouse   676 EAPRLTQNLTDLLVNVSDSLEMRCPVAGAH 705
            .||..|..|.|          |||| .|.|
  Fly   205 CAPGFTGPLCD----------MRCP-DGKH 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Flt4NP_032055.1 IG_like 238..327 CDD:214653
Ig1_VEGFR 245..329 CDD:143270
IG_like 341..415 CDD:214653
Ig 352..418 CDD:299845
Ig 569..662 CDD:299845 20/94 (21%)
IG 570..663 CDD:214652 20/94 (21%)
I-set 678..765 CDD:254352 10/28 (36%)
IGc2 693..755 CDD:197706 6/13 (46%)
PKc_like 837..1175 CDD:304357
Pkinase_Tyr 845..1169 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1288..1330
drprNP_001261276.1 EMI 27..92 CDD:284877 20/102 (20%)
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.