DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Flt1 and drpr

DIOPT Version :9

Sequence 1:NP_034358.2 Gene:Flt1 / 14254 MGIID:95558 Length:1333 Species:Mus musculus
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:242 Identity:52/242 - (21%)
Similarity:85/242 - (35%) Gaps:82/242 - (33%)


- Green bases have known domain annotations that are detailed below.


Mouse   221 YLTHRQTNTILDVQIRPPS---------PVRLLHGQTLVLNCTATTELNT---RVQMSWNYPGKA 273
            :.|| .||        |||         ||..:..:|.:|.....:::|.   |..||.:|....
  Fly   837 HYTH-DTN--------PPSWPPNHNFDNPVYGMQAETRLLPNNMRSKMNNFDQRSTMSTDYGDDC 892

Mouse   274 TKRASIRQRIDRSHSHNNVFHSVLKIN-NVESRDKGLYTCRVKSGSSFQSFNTSVHVYEKGFISV 337
            .....:     .|:| .|..|.:|..| |.:..:..:|...:|          ..|||::    :
  Fly   893 NASGRV-----GSYS-INYNHDLLTKNLNADRTNPIVYNESLK----------EEHVYDE----I 937

Mouse   338 KHR---KQPVQETTAGRRSYRLSMKVKAFPSPEIVWLKDGSPATLKSARYLVHGYSLIIKDVTTE 399
            ||:   |.||          ::..|: .||..|...|....|:|.:...|  |..:..:.::..:
  Fly   938 KHKEGYKDPV----------KIYSKI-LFPEDEYDHLDYSRPSTSQKPHY--HRMNDAMLNINQD 989

Mouse   400 DAGDYTILLGIKQSRLFKNLTATLIVNVKPQIYEKSVSSLPSPPLYP 446
            :.         |.|.: ||:|..|              :.|.||..|
  Fly   990 EE---------KPSNV-KNMTVLL--------------NKPLPPTEP 1012

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Flt1NP_034358.2 IG_like 40..129 CDD:214653
Ig 46..127 CDD:299845
IG_like 144..220 CDD:214653
IG_like 238..329 CDD:214653 20/103 (19%)
Ig 246..328 CDD:299845 16/85 (19%)
Ig 354..425 CDD:299845 15/70 (21%)
IG_like 440..553 CDD:214653 4/7 (57%)
Ig 452..550 CDD:143165
IG 570..641 CDD:214652
IGc2 570..641 CDD:197706
I-set 662..749 CDD:254352
IGc2 677..739 CDD:197706
PKc_like 820..1157 CDD:304357
Pkinase_Tyr 828..1154 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 947..983
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.