DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fli1 and Ets96B

DIOPT Version :9

Sequence 1:NP_032052.1 Gene:Fli1 / 14247 MGIID:95554 Length:452 Species:Mus musculus
Sequence 2:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster


Alignment Length:278 Identity:85/278 - (30%)
Similarity:130/278 - (46%) Gaps:61/278 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse   157 SFFQNMDGKELCKMNKEDFLRATSAYNTEVLLSHLSYLRESSLLAYNTTSHTDQSSRLNVKEDPS 221
            |.::::....|..::..|....:..||..:..::.|.||.:   ..::|:.:|...||    |..
  Fly   419 SVYRDLSPTTLAAVSDADLKYDSGPYNAAISSTYPSALRPN---VVDSTTSSDAELRL----DQF 476

Mouse   222 YDSVRRGAWNNNMNSGLNKSPLLGGSQTMGKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQF 286
            |.|       |.:::..|           |:...||                    .|.:|||||
  Fly   477 YAS-------NGISTSSN-----------GQAISQR--------------------RGSLQLWQF 503

Mouse   287 LLELLSD-SANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTK 350
            |:.||.: :.:||||.|.|...|||:.:|:|||||||.:|::|.||||||||:|||||:|.||.|
  Fly   504 LVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQK 568

Mouse   351 VHGKRYAYKF--DFHGIAQALQPHPTETSMYKYPSDISYMPSYHAHQQKVNFVPSHPSSMPVTSS 413
            |:|:||.|:|  |...:......|.|..|           .....||..::...:.|:|....:.
  Fly   569 VNGERYVYRFVCDPDALFNMAYGHLTTGS-----------GKGDQHQLTLSLAKTPPTSGDSQTQ 622

Mouse   414 SFFGAASQYWTSPTAGIY 431
            |...|.|:|:  .||.::
  Fly   623 SPRVAKSEYY--DTAALH 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fli1NP_032052.1 SAM_PNT-FLI-1 114..204 CDD:188883 8/46 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..260 4/23 (17%)
ETS 280..363 CDD:197710 51/85 (60%)
Ets96BNP_996290.1 ETS 497..583 CDD:197710 51/85 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.