Sequence 1: | NP_034351.2 | Gene: | Fkbp10 / 14230 | MGIID: | 104769 | Length: | 581 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001246448.1 | Gene: | Fkbp14 / 37449 | FlyBaseID: | FBgn0010470 | Length: | 220 | Species: | Drosophila melanogaster |
Alignment Length: | 211 | Identity: | 73/211 - (34%) |
---|---|---|---|
Similarity: | 118/211 - (55%) | Gaps: | 34/211 - (16%) |
- Green bases have known domain annotations that are detailed below.
Mouse 379 VEIKTLSRPPENCNETSKIGDFIRYHYNCSL-LDGTRLFSSHDYEAPQEITLGANKVIEGLDRGL 442
Mouse 443 QGMCVGERRQLIVPPHLAHGENGARGV-PGSAVLLFEVELVSREDGLPTGYLFVWYQDPSTSLFE 506
Mouse 507 DMDLNKDGEVPPEE----FSSFIKAQVNEGKGRLMPGQDP----------DKTISDMFQNQDRNQ 557
Mouse 558 DGKITAEELK-LKSDE 572 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fkbp10 | NP_034351.2 | FKBP_C | 54..146 | CDD:278674 | |
FKBP_C | 166..258 | CDD:278674 | |||
FKBP_C | 278..370 | CDD:278674 | |||
FKBP_C | 391..482 | CDD:278674 | 44/92 (48%) | ||
EF-hand_7 | 504..567 | CDD:290234 | 20/76 (26%) | ||
EFh | 505..566 | CDD:238008 | 19/74 (26%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 533..581 | 14/51 (27%) | |||
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 | 578..581 | ||||
Fkbp14 | NP_001246448.1 | FKBP_C | 37..130 | CDD:278674 | 44/92 (48%) |
EF-hand_7 | 140..212 | CDD:290234 | 19/76 (25%) | ||
EFh | 141..212 | CDD:298682 | 19/75 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0545 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1507309at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |