Sequence 1: | NP_034349.1 | Gene: | Fkbp4 / 14228 | MGIID: | 95543 | Length: | 458 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001246448.1 | Gene: | Fkbp14 / 37449 | FlyBaseID: | FBgn0010470 | Length: | 220 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 69/204 - (33%) |
---|---|---|---|
Similarity: | 95/204 - (46%) | Gaps: | 37/204 - (18%) |
- Green bases have known domain annotations that are detailed below.
Mouse 50 GDRVFVHYTGWL-LDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGEVCHITCKPEYAY 113
Mouse 114 GAAGSPPKIPPNATLVFEVELFEFKGEDLT----EEEDGGIIRRIRTRGEGYARPNDGAMVEVAL 174
Mouse 175 EGYHKDRLF-----DQRELCFEVGEGESLDLPCGLEEAIQRMEKGEHSIVYLKPSYAFGSVGKER 234
Mouse 235 FQIPPHAEL 243 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fkbp4 | NP_034349.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..24 | ||
FKBP_C | 43..134 | CDD:278674 | 43/84 (51%) | ||
Interaction with tubulin. /evidence=ECO:0000250 | 267..400 | ||||
TPR_11 | 274..349 | CDD:290150 | |||
TPR repeat | 274..301 | CDD:276809 | |||
TPR repeat | 306..348 | CDD:276809 | |||
TPR_1 | 321..352 | CDD:278916 | |||
TPR_11 | 322..384 | CDD:290150 | |||
TPR repeat | 353..381 | CDD:276809 | |||
TPR_1 | 354..386 | CDD:278916 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 428..458 | ||||
Fkbp14 | NP_001246448.1 | FKBP_C | 37..130 | CDD:278674 | 44/85 (52%) |
EF-hand_7 | 140..212 | CDD:290234 | 18/98 (18%) | ||
EFh | 141..212 | CDD:298682 | 18/97 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0545 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |