| Sequence 1: | NP_034349.1 | Gene: | Fkbp4 / 14228 | MGIID: | 95543 | Length: | 458 | Species: | Mus musculus |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001246448.1 | Gene: | Fkbp14 / 37449 | FlyBaseID: | FBgn0010470 | Length: | 220 | Species: | Drosophila melanogaster |
| Alignment Length: | 204 | Identity: | 69/204 - (33%) |
|---|---|---|---|
| Similarity: | 95/204 - (46%) | Gaps: | 37/204 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Mouse 50 GDRVFVHYTGWL-LDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGEVCHITCKPEYAY 113
Mouse 114 GAAGSPPKIPPNATLVFEVELFEFKGEDLT----EEEDGGIIRRIRTRGEGYARPNDGAMVEVAL 174
Mouse 175 EGYHKDRLF-----DQRELCFEVGEGESLDLPCGLEEAIQRMEKGEHSIVYLKPSYAFGSVGKER 234
Mouse 235 FQIPPHAEL 243 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Fkbp4 | NP_034349.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..24 | ||
| FKBP_C | 43..134 | CDD:278674 | 43/84 (51%) | ||
| Interaction with tubulin. /evidence=ECO:0000250 | 267..400 | ||||
| TPR_11 | 274..349 | CDD:290150 | |||
| TPR repeat | 274..301 | CDD:276809 | |||
| TPR repeat | 306..348 | CDD:276809 | |||
| TPR_1 | 321..352 | CDD:278916 | |||
| TPR_11 | 322..384 | CDD:290150 | |||
| TPR repeat | 353..381 | CDD:276809 | |||
| TPR_1 | 354..386 | CDD:278916 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 428..458 | ||||
| Fkbp14 | NP_001246448.1 | FKBP_C | 37..130 | CDD:278674 | 44/85 (52%) |
| EF-hand_7 | 140..212 | CDD:290234 | 18/98 (18%) | ||
| EFh | 141..212 | CDD:298682 | 18/97 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0545 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||