DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fhl3 and pk

DIOPT Version :9

Sequence 1:XP_006502829.1 Gene:Fhl3 / 14201 MGIID:1341092 Length:303 Species:Mus musculus
Sequence 2:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster


Alignment Length:272 Identity:75/272 - (27%)
Similarity:106/272 - (38%) Gaps:65/272 - (23%)


- Green bases have known domain annotations that are detailed below.


Mouse    59 QLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNECYCTAFSSQ--------- 114
            ||..||:     |.|:.|           ||.||    :..||       ..||:|         
  Fly   576 QLPPHDN-----EVRYCH-----------SLTDE----ERKEL-------RLFSTQRKRDALGRG 613

Mouse   115 ----------CSACGETVMPGSRKL---EYG-GQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCV 165
                      |..|.:.:..|...:   ..| ..:||..||.||.|.:.|....:....|..||.
  Fly   614 NVRQLMSARPCDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYCG 678

Mouse   166 PCYENKFAPRCARCSKTLTQGGVTYRD-QPWHRECLVCTGCKTPLAGQQFTSRDDDPYCVACFGE 229
            ..:.....|||:.|.:.:.....|..: :.||.....|..|...|.||::..|:..|||:.||..
  Fly   679 RHHAETLKPRCSACDEIILADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHCFDA 743

Mouse   230 LFAPKCSSCKRPITGGSGGGEGAGLGGGKYVSFEDRHWH--HSCFSCARCSTSLVGQGFVPDGDQ 292
            :||..|..|          ||..|:..|: :|.:.:|||  ..||||..|..||:|:.|:|....
  Fly   744 MFAEYCDYC----------GEAIGVDQGQ-MSHDGQHWHATDECFSCNTCRCSLLGRAFLPRRGA 797

Mouse   293 VLCQ-GCSQAGP 303
            :.|. .||:..|
  Fly   798 IYCSIACSKGEP 809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fhl3XP_006502829.1 LIM <19..47 CDD:351770
LIM1_FHL3 50..108 CDD:188807 13/48 (27%)
LIM2_FHL3 112..169 CDD:188811 17/79 (22%)
LIM3_FHL 176..227 CDD:188732 14/51 (27%)
LIM 235..299 CDD:351770 21/66 (32%)
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 16/68 (24%)
LIM1_Prickle 624..682 CDD:188799 15/57 (26%)
LIM2_Prickle 687..742 CDD:188802 17/54 (31%)
LIM3_Prickle 747..805 CDD:188804 21/68 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.