DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fgl2 and CG31832

DIOPT Version :9

Sequence 1:NP_032039.2 Gene:Fgl2 / 14190 MGIID:103266 Length:432 Species:Mus musculus
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:194 Identity:83/194 - (42%)
Similarity:113/194 - (58%) Gaps:17/194 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse   238 ETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNG 302
            :|....|.|:|.|||||.||.:.|..||.|||:...||::|..|::|:|:.:...|.|.|:...|
  Fly    50 KTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPG 114

Mouse   303 LTLYALYDQFYVANEFLKYRL-HIGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGL 366
            .|:||.:|.|.|.:|...|:| .:|.|:|||||:||:  |.|   :.|:|.|||||. .|.||..
  Fly   115 ATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLRY--HIN---KRFSTFDRDNDE-SSKNCAA 173

Mouse   367 YYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPKNF 430
            .:..||||.||||::|||.|:.:...|:.|||.||.|.          ..|....::|||||.|
  Fly   174 EHGGGWWFHSCLSSSLNGLYFREGETGMLNGIHWGRWK----------FQSLTFVQIMIRPKYF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fgl2NP_032039.2 Uds1 72..151 CDD:292096
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Fibrinogen_C 202..428 CDD:278572 80/190 (42%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 80/190 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4167
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.