DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fga and CG9500

DIOPT Version :9

Sequence 1:NP_001104518.1 Gene:Fga / 14161 MGIID:1316726 Length:789 Species:Mus musculus
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:295 Identity:94/295 - (31%)
Similarity:143/295 - (48%) Gaps:47/295 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse   507 SSSSKTSTV---KKQVTKTYKMADEAGSEAHREGETRNTKRGRARARPTRDCDDVLQTQTSG--- 565
            |.|.:..|.   |.::...||:......|......|.|.::..:         |:..|..||   
  Fly    23 SESFQNDTAIRNKPELKSLYKLVLALLEENQSNASTENIQKSSS---------DLNTTGLSGRYP 78

Mouse   566 -------AQNGIFSIKPPGSSKVFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLN 623
                   ..:||::::..| .|.|.|.||.|.:..||.::.:|....|||.|:|.:||.|||.| 
  Fly    79 SQCPTYPPAHGIYTVQVLG-LKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQL- 141

Mouse   624 DKGEGEFWLGNDYLHLLT-LRGSVLRVELEDWAGKEAYAEY-HFRVGSEAEGYAL-QVSSYRGTA 685
               :|:|::|.|.||.:| .:...|.:.|||:.|:..||.| ...:.||.:.||: ::..:.|.|
  Fly   142 ---DGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDA 203

Mouse   686 GDALVQGSVEEGTEYTSHSNMQFSTFDRDADQWEENCAEVYGGGWWYNSCQAANLNGIYYPGGTY 750
            ||:::.           :.|..|||||||.|.|.:||||.|.|.||:.:|..:||.|||..|   
  Fly   204 GDSMIH-----------NRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKG--- 254

Mouse   751 DPRNNSPYEIENGVVWVPFRGADYSLRAVRMKIRP 785
               :...|....|:||..:|...||.:.::|.:||
  Fly   255 ---DEGQYFQWKGIVWHSWRTESYSYKVMQMMVRP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FgaNP_001104518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..420
Fibrinogen_aC 392..457 CDD:288972
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 526..555 3/28 (11%)
FReD 550..786 CDD:238040 85/249 (34%)
Fib_alpha 51..190 CDD:285864
CG9500NP_609018.3 FReD 76..287 CDD:238040 81/233 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.