DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fga and CG31832

DIOPT Version :9

Sequence 1:NP_001104518.1 Gene:Fga / 14161 MGIID:1316726 Length:789 Species:Mus musculus
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:228 Identity:89/228 - (39%)
Similarity:127/228 - (55%) Gaps:30/228 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse   561 TQTSGAQNGIFSIKPPGSSKVFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDK 625
            |..||:.|||..:..|.........|  :|:...|::||:|:|||:|||::|..||.|||..|  
  Fly    24 TCPSGSPNGIHQLMLPEEEPFQVTQC--KTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPN-- 84

Mouse   626 GEGEFWLGNDYLHLLTL-RGSVLRVELEDWAGKEAYAEY-HFRVGSEAEGYALQ-VSSYRGTAGD 687
              |||::|...|:|:|. :...|.::|:...|...||.: .|:|.||.|.|.|: |..|.|||||
  Fly    85 --GEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGD 147

Mouse   688 ALVQGSVEEGTEYTSHSNMQFSTFDRDADQWEENCAEVYGGGWWYNSCQAANLNGIYYPGGTYDP 752
            :|         .|  |.|.:|||||||.|:..:|||..:|||||::||.:::|||:|:..|... 
  Fly   148 SL---------RY--HINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETG- 200

Mouse   753 RNNSPYEIENGVVWVPFRGADYSLRAVRMKIRP 785
                   :.||:.|  .|....||..|::.|||
  Fly   201 -------MLNGIHW--GRWKFQSLTFVQIMIRP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FgaNP_001104518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..420
Fibrinogen_aC 392..457 CDD:288972
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 526..555
FReD 550..786 CDD:238040 89/228 (39%)
Fib_alpha 51..190 CDD:285864
CG31832NP_723894.2 FReD 28..225 CDD:238040 87/224 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.