DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx1 and Fdx1

DIOPT Version :9

Sequence 1:NP_032022.1 Gene:Fdx1 / 14148 MGIID:103224 Length:188 Species:Mus musculus
Sequence 2:NP_001189075.1 Gene:Fdx1 / 39070 FlyBaseID:FBgn0011769 Length:172 Species:Drosophila melanogaster


Alignment Length:134 Identity:44/134 - (32%)
Similarity:82/134 - (61%) Gaps:3/134 - (2%)


- Green bases have known domain annotations that are detailed below.


Mouse    41 WTPSPRLHAEAGPGRPLSVSARARSSSEDKITVHFKNRDGETLTTKGKIGDSLLDVVIENNLDID 105
            :||...||... |.|......:...|:::.:.:.:.::||:....:||:||::|.:...:.::::
  Fly    28 YTPHNALHTTI-PRRHGEFEWQDPKSTDEIVNITYVDKDGKRTKVQGKVGDNVLYLAHRHGIEME 91

Mouse   106 GFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAFGLTDRSRLGCQVCLTKAMDNMTVR 170
              ||||.:|||:|||:..:....:||....::|:|:||:|..|.:.||||||:.|.|:|:.|.:.
  Fly    92 --GACEASLACTTCHVYVQHDYLQKLKEAEEQEDDLLDMAPFLRENSRLGCQILLDKSMEGMELE 154

Mouse   171 VPEA 174
            :|:|
  Fly   155 LPKA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx1NP_032022.1 fer2 71..174 CDD:294106 36/102 (35%)
Fdx1NP_001189075.1 PLN02593 57..172 CDD:178203 37/105 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0633
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1416
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100695
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R421
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.700

Return to query results.
Submit another query.