DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcna and CG9500

DIOPT Version :9

Sequence 1:NP_032021.1 Gene:Fcna / 14133 MGIID:1340905 Length:334 Species:Mus musculus
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:224 Identity:88/224 - (39%)
Similarity:122/224 - (54%) Gaps:16/224 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse   124 RSCKDLLTRGIF------------LTGWYTIHLPDCRPLTVLCDMDVDGGGWTVFQRRVDGSIDF 176
            :|..||.|.|:.            ..|.||:.:...:|..|.||.::.|.||||..||....::|
  Fly    63 KSSSDLNTTGLSGRYPSQCPTYPPAHGIYTVQVLGLKPFQVSCDAEIAGTGWTVMARRTSNKLNF 127

Mouse   177 FRDWDSYKRGFGNLGTEFWLGNDYLHLLTANGNQELRVDLQDFQGKGSYAKYSSFQVSEEQEKYK 241
            ||.|..||.|||.|..:|::|.|.||.:|.:...||.:.|:||:|:..||.|....:..|.:.|.
  Fly   128 FRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYA 192

Mouse   242 LT-LGQFLEGTAGDSLTKHNNMSFTTHDQDNDANSMNCAALFHGAWWYHNCHQSNLNGRYLSGSH 305
            :| ||:| .|.||||:..:.|.:|:|.|:|||....|||..:.||||:.||..|||.|.|:.|..
  Fly   193 MTKLGEF-TGDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDE 256

Mouse   306 ESYAD--GINWGTGQGHHYSYKVAEMKIR 332
            ..|..  ||.|.:.:...|||||.:|.:|
  Fly   257 GQYFQWKGIVWHSWRTESYSYKVMQMMVR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FcnaNP_032021.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..117
Collagen 65..106 CDD:189968
FReD 123..332 CDD:238040 87/222 (39%)
A domain, contributes to trimerization. /evidence=ECO:0000250 123..162 13/49 (27%)
B domain, contributes to trimerization. /evidence=ECO:0000250 163..251 36/88 (41%)
Carbohydrate-binding. /evidence=ECO:0000250|UniProtKB:O00602 290..292 1/1 (100%)
P domain. /evidence=ECO:0000250|UniProtKB:O00602 325..334 4/8 (50%)
CG9500NP_609018.3 FReD 76..287 CDD:238040 83/211 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I3887
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm43211
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.