DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcgr1 and bdl

DIOPT Version :9

Sequence 1:NP_034316.1 Gene:Fcgr1 / 14129 MGIID:95498 Length:404 Species:Mus musculus
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:421 Identity:92/421 - (21%)
Similarity:146/421 - (34%) Gaps:116/421 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse    32 AVITLQPPWVSIFQKENVTLWCEGPHLPGDSSTQWFINGTAVQ---------ISTP--SYSIPEA 85
            ::|.:.|...:|.:.:.....|...| |.:|...|:.:|..:|         ...|  |.||...
  Fly   151 SLIRIPPVNQTIREGQTAFFHCVMKH-PENSQASWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPT 214

Mouse    86 SFQDSGEYRCQIGSSMPSDPVQLQIHNDWLLLQASRRV--------LTEGEPLALRCH------- 135
            ...|.|||.|::.:|    ..:||....:|.:|...:|        |..|:|..|.||       
  Fly   215 MMSDLGEYECKVRNS----DGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPL 275

Mouse   136 ---GW-KNKLV---YNV--VFYR-NGKSFQFSSDSEVAILKTNLSHSGIYHCSGTGRHRYTSAGV 190
               .| |:.|:   |||  |||: ||..|         ..|.:.:|:|.|.|:     .|...|.
  Fly   276 KNLRWEKDGLLFDSYNVPGVFYKMNGSLF---------FAKVDENHAGSYTCT-----PYNDLGT 326

Mouse   191 SITVKELFTTPVLRASVSSPFPE-------GSLVTLNCETNLLLQRPGLQLHFSFYVGSK----- 243
            . ....:.:..|||..:.|..|:       |....|.||.   :.|.| ....|...|.|     
  Fly   327 D-GPSPVISVIVLRPPIFSVTPKAIYIQKLGEAAELPCEA---IDRDG-NNRPSIIWGRKDGQPL 386

Mouse   244 -ILEYRNTSSEYHIARAEREDAGFYWCEVATEDSSVLKRSPELELQVLGPQSSAP---------- 297
             ...:..:.....|......|.|.|.|. ||.:::.:....||.::.:.|:  ||          
  Fly   387 PADRFSLSGGNLTITGLVEGDRGIYECS-ATNEAATITAEAELMIENIAPR--APYNLTANSTET 448

Mouse   298 ------------------VWFHILFYLSVGIMFSLN-TVLYVKIHRLQREKKYNLEVPLVSEQGK 343
                              ||:.::.......:..|: .|:...:..||..|:|..   :|..|.|
  Fly   449 CITIRWQPGYLRPNLEYTVWYRLMEAPEWRTLRVLDKKVMEATVQHLQPGKEYEF---MVLSQDK 510

Mouse   344 KANSFQQVRSDGVYEEVTATASQTTPKEAPD 374
                    ..||::.:.....:..:|..|.|
  Fly   511 --------YGDGMFSKQFRFQTLPSPIRADD 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fcgr1NP_034316.1 Ig1_FcgammaR_like 32..110 CDD:143229 21/88 (24%)
IG_like 38..110 CDD:214653 20/82 (24%)
Ig 114..194 CDD:299845 28/104 (27%)
IG_like 125..194 CDD:214653 24/85 (28%)
ig 205..283 CDD:278476 18/90 (20%)
IG_like 213..271 CDD:214653 14/70 (20%)
Interaction with EPB41L2. /evidence=ECO:0000250 321..342 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 346..404 5/29 (17%)
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 23/93 (25%)
Ig 157..242 CDD:299845 22/89 (25%)
Ig_2 252..337 CDD:290606 25/99 (25%)
IG_like 260..327 CDD:214653 24/80 (30%)
I-set 341..428 CDD:254352 18/91 (20%)
IGc2 356..419 CDD:197706 16/67 (24%)
FN3 435..524 CDD:238020 16/101 (16%)
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.