DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRYAB and Hsp23

DIOPT Version :10

Sequence 1:NP_001876.1 Gene:CRYAB / 1410 HGNCID:2389 Length:175 Species:Homo sapiens
Sequence 2:NP_523999.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster


Alignment Length:113 Identity:49/113 - (43%)
Similarity:69/113 - (61%) Gaps:7/113 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    69 RLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTI 133
            ::.||.|.|.:||.||.|.||.|||..:.:.|.|.||||:|:||||:|.|.|:|.:|...:...:
  Fly    65 KIGKDGFQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKV 129

Human   134 TSSLSSDGVLTVNGPRK---QVSGPERTIPITREEKPA---VTAAPKK 175
            .|:||||||||:..|:.   :..|.||.:.| ::..||   |...||:
  Fly   130 ASTLSSDGVLTIKVPKPPAIEDKGNERIVQI-QQVGPAHLNVKENPKE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRYABNP_001876.1 Crystallin 1..55 CDD:425732
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 40/80 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..175 9/34 (26%)
Hsp23NP_523999.1 metazoan_ACD 67..145 CDD:107247 39/77 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.