DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRYAB and Hsp67Bc

DIOPT Version :9

Sequence 1:NP_001276736.1 Gene:CRYAB / 1410 HGNCID:2389 Length:175 Species:Homo sapiens
Sequence 2:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster


Alignment Length:120 Identity:47/120 - (39%)
Similarity:68/120 - (56%) Gaps:20/120 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    71 EKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITS 135
            ::..|.|:|||..|.|.||.||::.:.|.|.||||||:|:||.:||.|.|:|.:|.:.|...|.|
  Fly    77 KQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVS 141

Human   136 SLSSDGVLTVNGP----RKQVSGPERTIPIT--------------REEKPAVTAA 172
            :||.||||.:..|    ::::.  ||.|||.              :|..||.:|:
  Fly   142 TLSEDGVLNITVPPLVSKEELK--ERIIPIKHVGPSDLFQNGNGHKEAGPAASAS 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRYABNP_001276736.1 Crystallin 1..52 CDD:395419
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 38/82 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..175 10/45 (22%)
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 37/76 (49%)
IbpA <79..170 CDD:223149 42/92 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148909
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.