DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRYAB and hsp-12.2

DIOPT Version :10

Sequence 1:NP_001876.1 Gene:CRYAB / 1410 HGNCID:2389 Length:175 Species:Homo sapiens
Sequence 2:NP_498776.1 Gene:hsp-12.2 / 176148 WormBaseID:WBGene00002011 Length:110 Species:Caenorhabditis elegans


Alignment Length:93 Identity:38/93 - (40%)
Similarity:62/93 - (66%) Gaps:0/93 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    58 PSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKY 122
            |...:.|:.::...|::|.|.|||:.|:|:|::|||.|..:.:|.:||.|.|.||.::||.:|.|
 Worm    17 PLQHNDGVVKVHNTKEKFEVGLDVQFFTPKEIEVKVSGQELLIHCRHETRSDNHGTVAREINRAY 81

Human   123 RIPADVDPLTITSSLSSDGVLTVNGPRK 150
            ::|.|||..|:.|.|::.||||:...:|
 Worm    82 KLPDDVDVSTVKSHLATRGVLTITASKK 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRYABNP_001876.1 Crystallin 1..55 CDD:425732
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 35/82 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..175 1/5 (20%)
hsp-12.2NP_498776.1 metazoan_ACD 26..108 CDD:107247 35/81 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.