DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRYAA and Hsp67Ba

DIOPT Version :10

Sequence 1:NP_000385.1 Gene:CRYAA / 1409 HGNCID:2388 Length:173 Species:Homo sapiens
Sequence 2:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster


Alignment Length:111 Identity:38/111 - (34%)
Similarity:66/111 - (59%) Gaps:9/111 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    67 DRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSC 131
            :|:.|.:.::||.|:..:||||..|:.:.:.|:|:|::|.||.|||.|.|:|.||...|.:.:..
  Fly   123 NRNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHS 187

Human   132 SLSADGMLTFCGPK----IQTGLDATHAERAI---PVSREEKPTSA 170
            :||:||:||...|.    ::..|:  ..||.:   .:|:::|...|
  Fly   188 TLSSDGILTVKAPPPLPVVKGSLE--RQERIVDIQQISQQQKDKDA 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRYAANP_000385.1 Crystallin 1..54 CDD:425732
ACD_alphaA-crystallin_HspB4 60..145 CDD:107245 31/77 (40%)
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 31/75 (41%)
Agg_substance 226..>432 CDD:411439 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.