DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRYAA and CG14207

DIOPT Version :9

Sequence 1:NP_000385.1 Gene:CRYAA / 1409 HGNCID:2388 Length:173 Species:Homo sapiens
Sequence 2:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster


Alignment Length:117 Identity:35/117 - (29%)
Similarity:60/117 - (51%) Gaps:7/117 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    49 RQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISRE 113
            :|..:.:.:.|.:.:...|.....:..||..::||::.||..|..:.:|.||.|:.|... :.||
  Fly    82 KQQNYVSDISSPLIQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKS-VYRE 145

Human   114 FHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDA-THAERAIPVSRE 164
            ::|.:.||..|:..::..|||.||:||...|     |.| |..|..||::.:
  Fly   146 YNREFLLPKGVNPESIRSSLSKDGVLTVDAP-----LPALTAGETLIPIAHK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRYAANP_000385.1 Crystallin 1..51 CDD:395419 0/1 (0%)
ACD_alphaA-crystallin_HspB4 60..145 CDD:107245 26/84 (31%)
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 27/86 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148943
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.