DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBD2 and prkg2

DIOPT Version :9

Sequence 1:XP_011526892.1 Gene:CNBD2 / 140894 HGNCID:16145 Length:617 Species:Homo sapiens
Sequence 2:XP_021331649.1 Gene:prkg2 / 100125912 ZFINID:ZDB-GENE-060531-80 Length:769 Species:Danio rerio


Alignment Length:266 Identity:63/266 - (23%)
Similarity:113/266 - (42%) Gaps:56/266 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    26 SERQFEEESEEEPECLEIDFKSRTLSVRRFGLQGLYQLAMDIIIMIRVC---KMFRQGLRGFREY 87
            |.|.::|:|.::   |..|..::...:||..:|.:..:.        .|   :.::||     ||
Zfish   153 SARVWKEQSVKK---LLTDALNKNQYLRRLEVQQVKDMV--------ECMYERTYQQG-----EY 201

Human    88 QIIETAHWKHPIFSFWDKKMQSRVTFDTMDFIAEEGHFPPKAI----------QIMQKKPSWRTE 142
            .|.:.....| :|...|.|:........:..||....|...||          :......:|..:
Zfish   202 VIKQGEPGNH-LFVLADGKLDVYQHNKLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALD 265

Human   143 DEIQAVCNILQVL-----DSYRNYAEPLQLL-------LAKV---MRFERFGRRRVIIKKGQKGN 192
            .|:  ..||:::.     :.|||:...:.||       |.|:   :..|.:.:...||::|::||
Zfish   266 REV--FHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKLTKIVDCLEVEYYNKGDYIIREGEEGN 328

Human   193 SFYFIYLGTVAITKDEDGSSAFLDPHPKLLH---KGSCFGEMDVLHASVRRSTIVCMEE-TEFLV 253
            :||.|..|.:.:|:......     .|::::   ||..|||..::...||.:.|:..|: .|.||
Zfish   329 TFYIIANGKIKVTQSTQDHE-----EPQIINTLGKGDYFGEKALISDDVRSANIIAEEDGVECLV 388

Human   254 VDREDF 259
            :|||.|
Zfish   389 IDRETF 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBD2XP_011526892.1 Crp 151..>282 CDD:223736 36/128 (28%)
CAP_ED 163..259 CDD:237999 31/109 (28%)
prkg2XP_021331649.1 CAP_ED 176..284 CDD:237999 22/123 (18%)
CAP_ED 293..408 CDD:237999 32/107 (30%)
STKc_cGK 466..725 CDD:270724
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.